Lineage for d4lylj_ (4lyl J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2937388Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 2937389Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 2937390Protein Uracil-DNA glycosylase inhibitor protein [54443] (3 species)
  7. 2937395Species Bacteriophage pbs2 [TaxId:10684] [54445] (12 PDB entries)
  8. 2937414Domain d4lylj_: 4lyl J: [258929]
    Other proteins in same PDB: d4lyla1, d4lyla2, d4lylc1, d4lylc2, d4lyle1, d4lyle2, d4lylg1, d4lylg2, d4lyli1, d4lyli2, d4lylk1, d4lylk2, d4lylm1, d4lylm2, d4lylo1, d4lylo2
    automated match to d1ugia_
    protein/DNA complex

Details for d4lylj_

PDB Entry: 4lyl (more details), 1.93 Å

PDB Description: Crystal structure of uracil-DNA glycosylase from cod (Gadus morhua) in complex with the proteinaceous inhibitor UGI
PDB Compounds: (J:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d4lylj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lylj_ d.17.5.1 (J:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

SCOPe Domain Coordinates for d4lylj_:

Click to download the PDB-style file with coordinates for d4lylj_.
(The format of our PDB-style files is described here.)

Timeline for d4lylj_: