Lineage for d4lyle1 (4lyl E:85-304)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855022Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 2855023Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2855024Species Atlantic cod (Gadus morhua) [TaxId:8049] [102212] (2 PDB entries)
  8. 2855029Domain d4lyle1: 4lyl E:85-304 [258925]
    Other proteins in same PDB: d4lyla2, d4lylb_, d4lylc2, d4lyld_, d4lyle2, d4lylf_, d4lylg2, d4lylh_, d4lyli2, d4lylj_, d4lylk2, d4lyll_, d4lylm2, d4lyln_, d4lylo2, d4lylp_
    automated match to d1okba_
    protein/DNA complex

Details for d4lyle1

PDB Entry: 4lyl (more details), 1.93 Å

PDB Description: Crystal structure of uracil-DNA glycosylase from cod (Gadus morhua) in complex with the proteinaceous inhibitor UGI
PDB Compounds: (E:) uracil-DNA glycosylase

SCOPe Domain Sequences for d4lyle1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lyle1 c.18.1.1 (E:85-304) Uracil-DNA glycosylase {Atlantic cod (Gadus morhua) [TaxId: 8049]}
fgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvilgq
dpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvllln
avltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrhhvl
qavhpsplsahrgflgckhfskangllklsgtepinwral

SCOPe Domain Coordinates for d4lyle1:

Click to download the PDB-style file with coordinates for d4lyle1.
(The format of our PDB-style files is described here.)

Timeline for d4lyle1: