Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (24 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [187423] (4 PDB entries) |
Domain d4k1sb_: 4k1s B: [258916] automated match to d2vida_ |
PDB Entry: 4k1s (more details), 1.96 Å
SCOPe Domain Sequences for d4k1sb_:
Sequence, based on SEQRES records: (download)
>d4k1sb_ b.47.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} nvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdkgngg iysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikvigyp hpyknkyvlyestgpvmsvegssivysahtesgnsgspvlnsnnelvgihfasdvknddn rnaygvyftpeikkfiaenidk
>d4k1sb_ b.47.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} nvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdkgngg iysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikvigyp hpyknkyvlyestgpvmsvegssivysahtesgnsgspvlnsnnelvgihfasdvknnay gvyftpeikkfiaenidk
Timeline for d4k1sb_: