Lineage for d4k1ta1 (4k1t A:1-204)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066902Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2066903Protein automated matches [190438] (24 species)
    not a true protein
  7. 2067113Species Staphylococcus aureus [TaxId:1280] [187423] (4 PDB entries)
  8. 2067116Domain d4k1ta1: 4k1t A:1-204 [258915]
    Other proteins in same PDB: d4k1ta2, d4k1tb2, d4k1tc2
    automated match to d2vida_
    complexed with cl, so4, zn

Details for d4k1ta1

PDB Entry: 4k1t (more details), 1.6 Å

PDB Description: gly-ser-splb protease from staphylococcus aureus at 1.60 a resolution
PDB Compounds: (A:) serine protease splb

SCOPe Domain Sequences for d4k1ta1:

Sequence, based on SEQRES records: (download)

>d4k1ta1 b.47.1.0 (A:1-204) automated matches {Staphylococcus aureus [TaxId: 1280]}
ennvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdkgn
ggiysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikvig
yphpyknkyvlyestgpvmsvegssivysahtesgnsgspvlnsnnelvgihfasdvknd
dnrnaygvyftpeikkfiaenidk

Sequence, based on observed residues (ATOM records): (download)

>d4k1ta1 b.47.1.0 (A:1-204) automated matches {Staphylococcus aureus [TaxId: 1280]}
ennvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdkgn
ggiysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikvig
yphpyknkyvlyestgpvmsvegssivysahtesgnsgspvlnsnnelvgihfasddnrn
aygvyftpeikkfiaenidk

SCOPe Domain Coordinates for d4k1ta1:

Click to download the PDB-style file with coordinates for d4k1ta1.
(The format of our PDB-style files is described here.)

Timeline for d4k1ta1: