Lineage for d4k1ta_ (4k1t A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795550Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1795551Protein automated matches [190438] (20 species)
    not a true protein
  7. 1795711Species Staphylococcus aureus [TaxId:1280] [187423] (4 PDB entries)
  8. 1795714Domain d4k1ta_: 4k1t A: [258915]
    automated match to d2vida_
    complexed with cl, so4, zn

Details for d4k1ta_

PDB Entry: 4k1t (more details), 1.6 Å

PDB Description: gly-ser-splb protease from staphylococcus aureus at 1.60 a resolution
PDB Compounds: (A:) serine protease splb

SCOPe Domain Sequences for d4k1ta_:

Sequence, based on SEQRES records: (download)

>d4k1ta_ b.47.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gsennvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdk
gnggiysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikv
igyphpyknkyvlyestgpvmsvegssivysahtesgnsgspvlnsnnelvgihfasdvk
nddnrnaygvyftpeikkfiaenidk

Sequence, based on observed residues (ATOM records): (download)

>d4k1ta_ b.47.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gsennvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdk
gnggiysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikv
igyphpyknkyvlyestgpvmsvegssivysahtesgnsgspvlnsnnelvgihfasddn
rnaygvyftpeikkfiaenidk

SCOPe Domain Coordinates for d4k1ta_:

Click to download the PDB-style file with coordinates for d4k1ta_.
(The format of our PDB-style files is described here.)

Timeline for d4k1ta_: