Lineage for d4czma2 (4czm A:150-344)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2492703Species Caulobacter vibrioides [TaxId:155892] [256751] (9 PDB entries)
  8. 2492721Domain d4czma2: 4czm A:150-344 [258910]
    automated match to d1jcfa2
    complexed with anp, mg

Details for d4czma2

PDB Entry: 4czm (more details), 2.2 Å

PDB Description: c. crescentus mreb, monomeric, amppnp
PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d4czma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4czma2 c.55.1.0 (A:150-344) automated matches {Caulobacter vibrioides [TaxId: 155892]}
lpiheptgsmvvdigggttevavlslsgivysrsvrvggdkmdeaiisymrrhhnllige
ttaerikkeigtarapadgeglsidvkgrdlmqgvprevrisekqaadalaepvgqivea
vkvaleatppeladdiadkgimltgggallrgldaeirdhtglpvtvaddplscvalgcg
kvlehpkwmkgvles

SCOPe Domain Coordinates for d4czma2:

Click to download the PDB-style file with coordinates for d4czma2.
(The format of our PDB-style files is described here.)

Timeline for d4czma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4czma1