Lineage for d2bzaa_ (2bza A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 671094Protein Trypsin(ogen) [50515] (9 species)
  7. 671095Species Cow (Bos taurus) [TaxId:9913] [50516] (271 PDB entries)
  8. 671289Domain d2bzaa_: 2bza A: [25891]
    complexed with abn, ca, cl, so4

Details for d2bzaa_

PDB Entry: 2bza (more details), 1.9 Å

PDB Description: bovine pancreas beta-trypsin in complex with benzylamine
PDB Compounds: (A:) protein (trypsin)

SCOP Domain Sequences for d2bzaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzaa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d2bzaa_:

Click to download the PDB-style file with coordinates for d2bzaa_.
(The format of our PDB-style files is described here.)

Timeline for d2bzaa_: