Lineage for d4cv3b_ (4cv3 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1576689Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1577849Protein automated matches [190085] (43 species)
    not a true protein
  7. 1577956Species Escherichia coli [TaxId:469008] [256724] (2 PDB entries)
  8. 1577960Domain d4cv3b_: 4cv3 B: [258898]
    automated match to d1qg6a_
    complexed with nai, vt4

Details for d4cv3b_

PDB Entry: 4cv3 (more details), 1.95 Å

PDB Description: Crystal structure of E. coli FabI in complex with NADH and PT166
PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d4cv3b_:

Sequence, based on SEQRES records: (download)

>d4cv3b_ c.2.1.2 (B:) automated matches {Escherichia coli [TaxId: 469008]}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaamn

Sequence, based on observed residues (ATOM records): (download)

>d4cv3b_ c.2.1.2 (B:) automated matches {Escherichia coli [TaxId: 469008]}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpiceavtpirrtvtiedvgnsaaflcsdlsagisgevvhvdggfsiaamn

SCOPe Domain Coordinates for d4cv3b_:

Click to download the PDB-style file with coordinates for d4cv3b_.
(The format of our PDB-style files is described here.)

Timeline for d4cv3b_: