SCOPe 2.08: Domain d4cnzd_: 4cnz D:

Lineage for d4cnzd_ (4cnz D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (7 species)
   not a true protein

7. Species Azospirillum brasilense [TaxId:192] [189362] (11 PDB entries)

8. Domain d4cnzd_: 4cnz D: [258896]
   automated match to d3mhya_
   complexed with adp

Details for d4cnzd_

PDB Entry: 4cnz, 1.7 Å

PDB Description: structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate

PDB Compounds: (D:) PII-like protein Pz

SCOPe Domain Sequences for d4cnzd_:

Sequence, based on SEQRES records:

>d4cnzd_ d.58.5.1 (D:) automated matches {Azospirillum brasilense [TaxId: 192]}
mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk
vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal

Sequence, based on observed residues (ATOM records):

>d4cnzd_ d.58.5.1 (D:) automated matches {Azospirillum brasilense [TaxId: 192]}
mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgsflpkvkvevavsddqyeq
vveaiqkaantgrigdgkifvldiaqavrirtgetnteal

Timeline for d4cnzd_:

• d4cnzd_ first appeared in SCOPe 2.04
  
• d4cnzd_ appears in SCOPe 2.07