| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (9 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries) |
| Domain d4bz1l2: 4bz1 L:114-218 [258894] Other proteins in same PDB: d4bz1a_, d4bz1l1 automated match to d2fd6l2 complexed with cl, gol, na, zn |
PDB Entry: 4bz1 (more details), 2.15 Å
SCOPe Domain Sequences for d4bz1l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bz1l2 b.1.1.2 (L:114-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfapkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d4bz1l2: