SCOPe 2.08: Domain d4bz2a1: 4bz2 A:301-394

Lineage for d4bz2a1 (4bz2 A:301-394)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Dengue virus 4 [TaxId:11070] [195988] (5 PDB entries)

8. Domain d4bz2a1: 4bz2 A:301-394 [258887]
   Other proteins in same PDB: d4bz2a2, d4bz2a3, d4bz2h_, d4bz2l1, d4bz2l2
   automated match to d4am0s_
   complexed with cl, gol, na, peg

Details for d4bz2a1

PDB Entry: 4bz2, 2.03 Å

PDB Description: Structure of dengue virus EDIII in complex with Fab 2D73

PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d4bz2a1:

Sequence; same for both SEQRES and ATOM records:

>d4bz2a1 b.1.18.0 (A:301-394) automated matches {Dengue virus 4 [TaxId: 11070]}
mcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpfaey
tnsvtnieleppfgdsyivigvgdsaltlhwfrk

Timeline for d4bz2a1:

• d4bz2a1 first appeared in SCOPe 2.04, called d4bz2a_
  
• d4bz2a1 appears in SCOPe 2.07