| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein automated matches [190064] (21 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [258881] (6 PDB entries) |
| Domain d4by5b_: 4by5 B: [258886] automated match to d2lcpa_ complexed with ca, na |
PDB Entry: 4by5 (more details), 2.22 Å
SCOPe Domain Sequences for d4by5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4by5b_ a.39.1.5 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
nsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskf
aslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemyni
vdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqalsl
Timeline for d4by5b_: