![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein automated matches [190064] (21 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [258881] (6 PDB entries) |
![]() | Domain d4by5d_: 4by5 D: [258884] automated match to d2lcpa_ complexed with ca, na |
PDB Entry: 4by5 (more details), 2.22 Å
SCOPe Domain Sequences for d4by5d_:
Sequence, based on SEQRES records: (download)
>d4by5d_ a.39.1.5 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} klkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfas lvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemynivd aiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqal
>d4by5d_ a.39.1.5 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} klkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfas lvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemynivd aiyqmvpqkrvdkifdqmdknhddrltleefregskadprmvqal
Timeline for d4by5d_: