Lineage for d1ce5a_ (1ce5 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries) 
Domain d1ce5a_: 1ce5 A: [25888]
Details for d1ce5a_
PDB Entry: 1ce5 (more details), 1.9 Å
PDB Description: bovine pancreas beta-trypsin in complex with benzamidine
SCOP Domain Sequences for d1ce5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ce5a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d1ce5a_:
Click to download the PDB-style file with coordinates for d1ce5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ce5a_:
- d1ce5a_ appears in SCOP 1.57
- d1ce5a_ appears in the current release, SCOPe 2.08
View in 3D