SCOPe 2.06: Domain d3wf9a_: 3wf9 A:

Lineage for d3wf9a_ (3wf9 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries)

8. Domain d3wf9a_: 3wf9 A: [258877]
   automated match to d4nusa_
   complexed with fs7, gol, zn

Details for d3wf9a_

PDB Entry: 3wf9, 2.04 Å

PDB Description: Crystal structure of S6K1 kinase domain in complex with a quinoline derivative 1-oxo-1-[(4-sulfamoylphenyl)amino]propan-2-yl-2-methyl-1,2,3,4-tetrahydroacridine-9-carboxylate

PDB Compounds: (A:) Ribosomal protein S6 kinase beta-1

SCOPe Domain Sequences for d3wf9a_:

Sequence; same for both SEQRES and ATOM records:

>d3wf9a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kirpecfellrvlgkggygkvfqvrkvtgantgkifamkvlkkamivrnakdtahtkaer
nileevkhpfivdliyafqtggklylileylsggelfmqleregifmedtacfylaeism
alghlhqkgiiyrdlkpenimlnhqghvkltdfglckesihdgtvthtfcgtieymapei
lmrsghnravdwwslgalmydmltgappftgenrkktidkilkcklnlppyltqeardll
kkllkrnaasrlgagpgdagevqahpffrhinweellarkveppfkpl

Timeline for d3wf9a_:

• d3wf9a_ first appeared in SCOPe 2.04
  
• d3wf9a_ appears in SCOPe 2.05
  
• d3wf9a_ appears in SCOPe 2.07
  
• d3wf9a_ appears in the current release, SCOPe 2.08