SCOPe 2.08: Domain d3wfwa1: 3wfw A:1-133

Lineage for d3wfwa1 (3wfw A:1-133)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (26 species)
   not a true protein

7. Species Methylacidiphilum infernorum [TaxId:481448] [195689] (5 PDB entries)

8. Domain d3wfwa1: 3wfw A:1-133 [258874]
   Other proteins in same PDB: d3wfwa2
   automated match to d2gdma_
   complexed with hem, mpd

Details for d3wfwa1

PDB Entry: 3wfw, 1.65 Å

PDB Description: crystal structure of the closed form of the hgbrl's globin domain

PDB Compounds: (A:) Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain

SCOPe Domain Sequences for d3wfwa1:

Sequence; same for both SEQRES and ATOM records:

>d3wfwa1 a.1.1.0 (A:1-133) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}
mtreeikmiqkswlrvidkmdeagllfyrrlfdvepkvrplfkidiekqgrklmdvlnwi
vlnlqdidaaldaarelarrhvkygvkaehypvvghtliwtlrkmigsewtkqleqlwtq
ayealaqvmieeh

Timeline for d3wfwa1:

• d3wfwa1 first appeared in SCOPe 2.04, called d3wfwa_
  
• d3wfwa1 appears in SCOPe 2.07