Lineage for d3wfwa1 (3wfw A:1-133)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689484Species Methylacidiphilum infernorum [TaxId:481448] [195689] (5 PDB entries)
  8. 2689491Domain d3wfwa1: 3wfw A:1-133 [258874]
    Other proteins in same PDB: d3wfwa2
    automated match to d2gdma_
    complexed with hem, mpd

Details for d3wfwa1

PDB Entry: 3wfw (more details), 1.65 Å

PDB Description: crystal structure of the closed form of the hgbrl's globin domain
PDB Compounds: (A:) Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain

SCOPe Domain Sequences for d3wfwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wfwa1 a.1.1.0 (A:1-133) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}
mtreeikmiqkswlrvidkmdeagllfyrrlfdvepkvrplfkidiekqgrklmdvlnwi
vlnlqdidaaldaarelarrhvkygvkaehypvvghtliwtlrkmigsewtkqleqlwtq
ayealaqvmieeh

SCOPe Domain Coordinates for d3wfwa1:

Click to download the PDB-style file with coordinates for d3wfwa1.
(The format of our PDB-style files is described here.)

Timeline for d3wfwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wfwa2