![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
![]() | Protein automated matches [190590] (26 species) not a true protein |
![]() | Species Methylacidiphilum infernorum [TaxId:481448] [195689] (5 PDB entries) |
![]() | Domain d3wfxb1: 3wfx B:1-133 [258873] Other proteins in same PDB: d3wfxa2, d3wfxb2 automated match to d2gdma_ complexed with hem, hez, imd |
PDB Entry: 3wfx (more details), 1.94 Å
SCOPe Domain Sequences for d3wfxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wfxb1 a.1.1.0 (B:1-133) automated matches {Methylacidiphilum infernorum [TaxId: 481448]} mtreeikmiqkswlrvidkmdeagllfyrrlfdvepkvrplfkidiekqgrklmdvlnwi vlnlqdidaaldaarelarrhvkygvkaehypvvghtliwtlrkmigsewtkqleqlwtq ayealaqvmieeh
Timeline for d3wfxb1: