Lineage for d3wcue_ (3wcu E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718504Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1718505Protein automated matches [190590] (18 species)
    not a true protein
  7. 1718539Species Lamellibrachia satsuma [TaxId:104711] [256471] (4 PDB entries)
  8. 1718568Domain d3wcue_: 3wcu E: [258869]
    automated match to d1yhua_
    complexed with ca, hem

Details for d3wcue_

PDB Entry: 3wcu (more details), 2.9 Å

PDB Description: the structure of a deoxygenated 400 kda hemoglobin provides a more accurate description of the cooperative mechanism of giant hemoglobins: deoxygenated form
PDB Compounds: (E:) A1 globin chain of giant V2 hemoglobin

SCOPe Domain Sequences for d3wcue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wcue_ a.1.1.0 (E:) automated matches {Lamellibrachia satsuma [TaxId: 104711]}
dcnilqrlkvkmqwakaygfgterakfgnslwtsifnyapdardlfksvksedmrspqfk
ahiarviggldrvismfdnedalnadlehlksqhdprgldalnfvvfgkalfatvggqfg
vcfdlpawescykviamgitgndmfs

SCOPe Domain Coordinates for d3wcue_:

Click to download the PDB-style file with coordinates for d3wcue_.
(The format of our PDB-style files is described here.)

Timeline for d3wcue_: