| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
| Protein automated matches [190590] (15 species) not a true protein |
| Species Lamellibrachia satsuma [TaxId:104711] [256471] (4 PDB entries) |
| Domain d3wcvd_: 3wcv D: [258868] automated match to d2zs0c_ complexed with ca, hem, oxy |
PDB Entry: 3wcv (more details), 2.6 Å
SCOPe Domain Sequences for d3wcvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wcvd_ a.1.1.0 (D:) automated matches {Lamellibrachia satsuma [TaxId: 104711]}
fcseadativikqwnqiynagigaksrwtmgneifsslfklkpesevlfnnvnvanmssg
afhahtvrvlsgldmginylndagtltsltahlaaqhvartglkavyfdamgkvlmtvlp
slidnfnpdawrncllplknaiakglp
Timeline for d3wcvd_: