SCOPe 2.04: Domain d3wcvc_: 3wcv C:

Lineage for d3wcvc_ (3wcv C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (15 species)
   not a true protein

7. Species Lamellibrachia satsuma [TaxId:104711] [256471] (4 PDB entries)

8. Domain d3wcvc_: 3wcv C: [258864]
   automated match to d2zs0c_
   complexed with ca, hem, oxy

Details for d3wcvc_

PDB Entry: 3wcv, 2.6 Å

PDB Description: the structure of a deoxygenated 400 kda hemoglobin provides a more accurate description of the cooperative mechanism of giant hemoglobins: ca bound form

PDB Compounds: (C:) B2 globin chain of giant V2 hemoglobin

SCOPe Domain Sequences for d3wcvc_:

Sequence; same for both SEQRES and ATOM records:

>d3wcvc_ a.1.1.0 (C:) automated matches {Lamellibrachia satsuma [TaxId: 104711]}
ssnscttedrremqlmwanvwsaqftgrrlaiaqavfkdlfahvpdavglfdrvhgteid
ssefkahcirvvngldsaigllsdpstlneqlshlatqhqeragvtkggfsaiaqsflrv
mpqvascfnpdawsrcfnritngmteglae

Timeline for d3wcvc_:

• d3wcvc_ is new in SCOPe 2.04-stable
  
• d3wcvc_ appears in SCOPe 2.05
  
• d3wcvc_ appears in the current release, SCOPe 2.08