SCOPe 2.04: Domain d3wcua_: 3wcu A:

Lineage for d3wcua_ (3wcu A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (15 species)
   not a true protein

7. Species Lamellibrachia satsuma [TaxId:104711] [256471] (4 PDB entries)

8. Domain d3wcua_: 3wcu A: [258859]
   automated match to d1yhua_

Details for d3wcua_

PDB Entry: 3wcu, 2.9 Å

PDB Description: the structure of a deoxygenated 400 kda hemoglobin provides a more accurate description of the cooperative mechanism of giant hemoglobins: deoxygenated form

PDB Compounds: (A:) A1 globin chain of giant V2 hemoglobin

SCOPe Domain Sequences for d3wcua_:

Sequence; same for both SEQRES and ATOM records:

>d3wcua_ a.1.1.0 (A:) automated matches {Lamellibrachia satsuma [TaxId: 104711]}
dcnilqrlkvkmqwakaygfgterakfgnslwtsifnyapdardlfksvksedmrspqfk
ahiarviggldrvismfdnedalnadlehlksqhdprgldalnfvvfgkalfatvggqfg
vcfdlpawescykviamgitgndmfs

Timeline for d3wcua_:

• d3wcua_ is new in SCOPe 2.04-stable
  
• d3wcua_ appears in SCOPe 2.05
  
• d3wcua_ appears in the current release, SCOPe 2.08