Lineage for d3wcwd_ (3wcw D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689451Species Lamellibrachia satsuma [TaxId:104711] [256471] (4 PDB entries)
  8. 2689463Domain d3wcwd_: 3wcw D: [258857]
    automated match to d2zs0c_
    complexed with hem, mg, oxy

Details for d3wcwd_

PDB Entry: 3wcw (more details), 2.5 Å

PDB Description: the structure of a deoxygenated 400 kda hemoglobin provides a more accurate description of the cooperative mechanism of giant hemoglobins: mg bound form
PDB Compounds: (D:) B1 globin chain of giant V2 hemoglobin

SCOPe Domain Sequences for d3wcwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wcwd_ a.1.1.0 (D:) automated matches {Lamellibrachia satsuma [TaxId: 104711]}
fcseadativikqwnqiynagigaksrwtmgneifsslfklkpesevlfnnvnvanmssg
afhahtvrvlsgldmginylndagtltsltahlaaqhvartglkavyfdamgkvlmtvlp
slidnfnpdawrncllplknaiakglp

SCOPe Domain Coordinates for d3wcwd_:

Click to download the PDB-style file with coordinates for d3wcwd_.
(The format of our PDB-style files is described here.)

Timeline for d3wcwd_: