Lineage for d3wcwf_ (3wcw F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718504Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1718505Protein automated matches [190590] (18 species)
    not a true protein
  7. 1718539Species Lamellibrachia satsuma [TaxId:104711] [256471] (4 PDB entries)
  8. 1718553Domain d3wcwf_: 3wcw F: [258849]
    automated match to d1x9fb_
    complexed with hem, mg, oxy

Details for d3wcwf_

PDB Entry: 3wcw (more details), 2.5 Å

PDB Description: the structure of a deoxygenated 400 kda hemoglobin provides a more accurate description of the cooperative mechanism of giant hemoglobins: mg bound form
PDB Compounds: (F:) A2 globin chain of giant V2 hemoglobin

SCOPe Domain Sequences for d3wcwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wcwf_ a.1.1.0 (F:) automated matches {Lamellibrachia satsuma [TaxId: 104711]}
secgplqrlkvkrqwaeaygsgngreefghfiwanvfkvapsardmfkrvrgdniytpaf
rahatrvlggldmcvallddesvlntqlahlasqhssrgvsaeqynvvehavmmgvehei
gqnvfdkdawqacldvitsgiqgn

SCOPe Domain Coordinates for d3wcwf_:

Click to download the PDB-style file with coordinates for d3wcwf_.
(The format of our PDB-style files is described here.)

Timeline for d3wcwf_: