Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Lamellibrachia satsuma [TaxId:104711] [256471] (4 PDB entries) |
Domain d3wcwf_: 3wcw F: [258849] automated match to d1x9fb_ complexed with hem, mg, oxy |
PDB Entry: 3wcw (more details), 2.5 Å
SCOPe Domain Sequences for d3wcwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wcwf_ a.1.1.0 (F:) automated matches {Lamellibrachia satsuma [TaxId: 104711]} secgplqrlkvkrqwaeaygsgngreefghfiwanvfkvapsardmfkrvrgdniytpaf rahatrvlggldmcvallddesvlntqlahlasqhssrgvsaeqynvvehavmmgvehei gqnvfdkdawqacldvitsgiqgn
Timeline for d3wcwf_: