Lineage for d4u6hd2 (4u6h D:113-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753323Domain d4u6hd2: 4u6h D:113-218 [258844]
    Other proteins in same PDB: d4u6ha1, d4u6ha2, d4u6hb1, d4u6hc1, d4u6hc2, d4u6hd1
    automated match to d1t66c2

Details for d4u6hd2

PDB Entry: 4u6h (more details), 3.1 Å

PDB Description: vaccinia l1/m12b9-fab complex
PDB Compounds: (D:) Light chain of murine anti-vaccinia L1 IgG2a antibody M12B9

SCOPe Domain Sequences for d4u6hd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u6hd2 b.1.1.2 (D:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4u6hd2:

Click to download the PDB-style file with coordinates for d4u6hd2.
(The format of our PDB-style files is described here.)

Timeline for d4u6hd2: