Lineage for d4tthb_ (4tth B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930210Protein Cyclin-dependent PK, CDK6 [88859] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1930211Species Human (Homo sapiens) [TaxId:9606] [88860] (13 PDB entries)
  8. 1930224Domain d4tthb_: 4tth B: [258840]
    Other proteins in same PDB: d4ttha1, d4ttha2
    automated match to d1blxa_
    complexed with 24v

Details for d4tthb_

PDB Entry: 4tth (more details), 2.9 Å

PDB Description: crystal structure of a cdk6/vcyclin complex with inhibitor bound
PDB Compounds: (B:) cyclin-dependent kinase 6

SCOPe Domain Sequences for d4tthb_:

Sequence, based on SEQRES records: (download)

>d4tthb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
cvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhletfehp
nvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgld
flhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapevllqs
syatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdvalprqaf
hsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdle

Sequence, based on observed residues (ATOM records): (download)

>d4tthb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
cvaeigekvfkardlkngrfvalkrvrvegmplstirevavlrhletfehpnvvrlfdvc
ttkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdlkpqn
ilvtssgqikladfglariysfqmaltsvvvtlwyrapevllqssyatpvdlwsvgcifa
emfrrkplfrgssdvdqlgkildviglpgeedwppiekfdidelgkdlllkcltfnpakr
isaysalshpyfqdle

SCOPe Domain Coordinates for d4tthb_:

Click to download the PDB-style file with coordinates for d4tthb_.
(The format of our PDB-style files is described here.)

Timeline for d4tthb_: