Lineage for d4uo4b_ (4uo4 B:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709924Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 1709925Protein automated matches [254645] (6 species)
    not a true protein
  7. 1709945Species Influenza A virus [TaxId:11320] [255657] (3 PDB entries)
  8. 1709947Domain d4uo4b_: 4uo4 B: [258839]
    Other proteins in same PDB: d4uo4a_
    automated match to d4n5zb_
    complexed with nag, so4

Details for d4uo4b_

PDB Entry: 4uo4 (more details), 2.6 Å

PDB Description: Structure of the A_Canine_Colorado_17864_06 H3 haemagglutinin
PDB Compounds: (B:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4uo4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo4b_ h.3.1.0 (B:) automated matches {Influenza A virus [TaxId: 11320]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfqsgr

SCOPe Domain Coordinates for d4uo4b_:

Click to download the PDB-style file with coordinates for d4uo4b_.
(The format of our PDB-style files is described here.)

Timeline for d4uo4b_:

  • d4uo4b_ appears in periodic updates to SCOPe 2.04 starting on 2014-08-07
  • d4uo4b_ appears in SCOPe 2.05
  • d4uo4b_ appears in the current release, SCOPe 2.07, called d4uo4b1