| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
| Protein automated matches [254645] (42 species) not a true protein |
| Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries) |
| Domain d4uo4b1: 4uo4 B:1-172 [258839] Other proteins in same PDB: d4uo4a_, d4uo4b2 automated match to d4n5zb_ complexed with nag, so4 |
PDB Entry: 4uo4 (more details), 2.6 Å
SCOPe Domain Sequences for d4uo4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo4b1 h.3.1.0 (B:1-172) automated matches {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfq
Timeline for d4uo4b1: