SCOPe 2.08: Domain d4uo4b1: 4uo4 B:1-172

Lineage for d4uo4b1 (4uo4 B:1-172)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)

8. Domain d4uo4b1: 4uo4 B:1-172 [258839]
   Other proteins in same PDB: d4uo4a_, d4uo4b2
   automated match to d4n5zb_
   complexed with nag, so4

Details for d4uo4b1

PDB Entry: 4uo4, 2.6 Å

PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin

PDB Compounds: (B:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4uo4b1:

Sequence; same for both SEQRES and ATOM records:

>d4uo4b1 h.3.1.0 (B:1-172) automated matches {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfq

Timeline for d4uo4b1:

• d4uo4b1 first appeared in SCOPe 2.04, called d4uo4b_
  
• d4uo4b1 appears in SCOPe 2.07