Lineage for d4uo4b1 (4uo4 B:1-172)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (32 species)
    not a true protein
  7. 2592447Species Influenza A virus, different strains [TaxId:11320] [255657] (8 PDB entries)
  8. 2592449Domain d4uo4b1: 4uo4 B:1-172 [258839]
    Other proteins in same PDB: d4uo4a_, d4uo4b2
    automated match to d4n5zb_
    complexed with nag, so4

Details for d4uo4b1

PDB Entry: 4uo4 (more details), 2.6 Å

PDB Description: Structure of the A_Canine_Colorado_17864_06 H3 haemagglutinin
PDB Compounds: (B:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4uo4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo4b1 h.3.1.0 (B:1-172) automated matches {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfq

SCOPe Domain Coordinates for d4uo4b1:

Click to download the PDB-style file with coordinates for d4uo4b1.
(The format of our PDB-style files is described here.)

Timeline for d4uo4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4uo4b2
View in 3D
Domains from other chains:
(mouse over for more information)
d4uo4a_