SCOPe 2.07: Domain d4uo4a_: 4uo4 A:

Lineage for d4uo4a_ (4uo4 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (21 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [187142] (20 PDB entries)

8. Domain d4uo4a_: 4uo4 A: [258838]
   Other proteins in same PDB: d4uo4b1, d4uo4b2
   automated match to d1hgea_
   complexed with nag, so4

Details for d4uo4a_

PDB Entry: 4uo4, 2.6 Å

PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin

PDB Compounds: (A:) h3 haemagglutinin ha1 chain

SCOPe Domain Sequences for d4uo4a_:

Sequence; same for both SEQRES and ATOM records:

>d4uo4a_ b.19.1.2 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
nntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildgrnctli
damlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveftaegftw
tgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgihhpss
nqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvtygkcpk
yirqntlklatgmrnvpek

Timeline for d4uo4a_:

• d4uo4a_ first appeared in SCOPe 2.04
  
• d4uo4a_ appears in SCOPe 2.06
  
• d4uo4a_ appears in the current release, SCOPe 2.08