Lineage for d4txea_ (4txe A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2418914Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188036] (5 PDB entries)
  8. 2418918Domain d4txea_: 4txe A: [258833]
    automated match to d2uy2a_
    complexed with 38f

Details for d4txea_

PDB Entry: 4txe (more details), 1.8 Å

PDB Description: ScCTS1 in complex with compound 5
PDB Compounds: (A:) Endochitinase

SCOPe Domain Sequences for d4txea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4txea_ c.1.8.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
antniavywgqnsagtqeslatycessdadifllsflnqfptlglnfanacsdtfsdgll
hctqiaedietcqslgkkvllslggasgsylfsddsqaetfaqtlwdtfgegtgaserpf
dsavvdgfdfdiennnevgysalatklrtlfaegtkqyylsaapqcpypdasvgdllena
didfafiqfynnycsvsgqfnwdtwltyaqtvspnkniklflglpgsasaagsgyisdts
llestiadiassssfggialwdasqafsnelngepyveilknlltsas

SCOPe Domain Coordinates for d4txea_:

Click to download the PDB-style file with coordinates for d4txea_.
(The format of our PDB-style files is described here.)

Timeline for d4txea_: