![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Viral cyclin [47961] (3 species) |
![]() | Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries) |
![]() | Domain d4ttha2: 4tth A:149-254 [258832] Other proteins in same PDB: d4tthb_ automated match to d1jowa2 complexed with 24v |
PDB Entry: 4tth (more details), 2.9 Å
SCOPe Domain Sequences for d4ttha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ttha2 a.74.1.1 (A:149-254) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} avlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicaggllttie tdntncrpwtcyledlssilnfstntvrtvkdqvseafslydleil
Timeline for d4ttha2: