SCOPe 2.06: Domain d4ttha1: 4tth A:8-148

Lineage for d4ttha1 (4tth A:8-148)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Viral cyclin [47961] (3 species)

7. Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries)

8. Domain d4ttha1: 4tth A:8-148 [258831]
   Other proteins in same PDB: d4tthb_
   automated match to d1jowa1
   complexed with 24v

Details for d4ttha1

PDB Entry: 4tth, 2.9 Å

PDB Description: crystal structure of a cdk6/vcyclin complex with inhibitor bound

PDB Compounds: (A:) cyclin homolog

SCOPe Domain Sequences for d4ttha1:

Sequence, based on SEQRES records:

>d4ttha1 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcf
tnlelinqekdilealkwdte

Sequence, based on observed residues (ATOM records):

>d4ttha1 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnl
elinqekdilealkwdte

Timeline for d4ttha1:

• d4ttha1 first appeared in SCOPe 2.04
  
• d4ttha1 appears in SCOPe 2.05
  
• d4ttha1 appears in SCOPe 2.07
  
• d4ttha1 appears in the current release, SCOPe 2.08