Lineage for d4ttha1 (4tth A:8-148)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000824Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2000825Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2000826Family a.74.1.1: Cyclin [47955] (9 protein domains)
  6. 2001240Protein Viral cyclin [47961] (3 species)
  7. 2001241Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries)
  8. 2001250Domain d4ttha1: 4tth A:8-148 [258831]
    Other proteins in same PDB: d4tthb_
    automated match to d1jowa1
    complexed with 24v

Details for d4ttha1

PDB Entry: 4tth (more details), 2.9 Å

PDB Description: crystal structure of a cdk6/vcyclin complex with inhibitor bound
PDB Compounds: (A:) cyclin homolog

SCOPe Domain Sequences for d4ttha1:

Sequence, based on SEQRES records: (download)

>d4ttha1 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcf
tnlelinqekdilealkwdte

Sequence, based on observed residues (ATOM records): (download)

>d4ttha1 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnl
elinqekdilealkwdte

SCOPe Domain Coordinates for d4ttha1:

Click to download the PDB-style file with coordinates for d4ttha1.
(The format of our PDB-style files is described here.)

Timeline for d4ttha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ttha2
View in 3D
Domains from other chains:
(mouse over for more information)
d4tthb_