SCOPe 2.06: Domain d4tx9a1: 4tx9 A:1-245

Lineage for d4tx9a1 (4tx9 A:1-245)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold
   automatically mapped to Pfam PF00977

6. Protein automated matches [190186] (10 species)
   not a true protein

7. Species Streptomyces sviceus [TaxId:463191] [258540] (2 PDB entries)

8. Domain d4tx9a1: 4tx9 A:1-245 [258830]
   Other proteins in same PDB: d4tx9a2
   automated match to d2vepa_
   complexed with amz, so4

Details for d4tx9a1

PDB Entry: 4tx9, 1.6 Å

PDB Description: crystal structure of hisap from streptomyces sviceus with degraded profar

PDB Compounds: (A:) phosphoribosyl isomerase a

SCOPe Domain Sequences for d4tx9a1:

Sequence; same for both SEQRES and ATOM records:

>d4tx9a1 c.1.2.1 (A:1-245) automated matches {Streptomyces sviceus [TaxId: 463191]}
mpsklsrlellpavdvrdgqavrlvhgesgtetsygspleaalswqragaewlhlvdlda
afgtgdnrelvrqvteamdikvelsggirddaslaaalatgctrvnlgtaalespewvak
viaehgdriavgldvrgttlkgrgwtseggdlyealerldkegcaryvvtdiakdgtlqg
pnlellrnvcaatdrpvvasggvsslddlraiaelvplgvegsivgkalyakaftleeal
eavaq

Timeline for d4tx9a1:

• d4tx9a1 first appeared in SCOPe 2.04, called d4tx9a_
  
• d4tx9a1 was called d4tx9a_ in SCOPe 2.05
  
• d4tx9a1 appears in SCOPe 2.07
  
• d4tx9a1 appears in the current release, SCOPe 2.08