Lineage for d4trrg_ (4trr G:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580416Species Burkholderia cenocepacia [TaxId:216591] [193149] (5 PDB entries)
  8. 1580432Domain d4trrg_: 4trr G: [258827]
    automated match to d1zjya1
    complexed with edo, so4

Details for d4trrg_

PDB Entry: 4trr (more details), 1.9 Å

PDB Description: crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315
PDB Compounds: (G:) Putative D-beta-hydroxybutyrate dehydrogenase

SCOPe Domain Sequences for d4trrg_:

Sequence, based on SEQRES records: (download)

>d4trrg_ c.2.1.0 (G:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
ngktavvtgaasgigkeialelakagaavaiadlnqdganavadeinkaggkaigvamdv
tneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgaflttka
alkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvrshvv
cpgfvrtplvdkqipeqakelgiseeevikkvmlgntvdgvfttvqdvaqtvlflsafps
aaltgqsfivshgwfmq

Sequence, based on observed residues (ATOM records): (download)

>d4trrg_ c.2.1.0 (G:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
ngktavvtgaasgigkeialelakagaavaiadlnqdganavakaigvamdvtneeavnt
gidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgaflttkaalkhmykd
drggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvrshvvcpgfvrtp
lmlgntvdgvfttvqdvaqtvlflsafpsaaltgqsfivshgwfmq

SCOPe Domain Coordinates for d4trrg_:

Click to download the PDB-style file with coordinates for d4trrg_.
(The format of our PDB-style files is described here.)

Timeline for d4trrg_: