SCOP 1.73: Domain d1xuia_: 1xui A:

Lineage for d1xuia_ (1xui A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (271 PDB entries)

8. Domain d1xuia_: 1xui A: [25882]
   complexed with bao, ca, na

Details for d1xuia_

PDB Entry: 1xui, 1.5 Å

PDB Description: trypsin-keto-babim, zn+2-free, ph 8.2

PDB Compounds: (A:) Trypsin

SCOP Domain Sequences for d1xuia_:

Sequence; same for both SEQRES and ATOM records:

>d1xuia_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1xuia_:

• d1xuia_ first appeared (with stable ids) in SCOP 1.55, called d1xui__
  
• d1xuia_ was called d1xui__ in SCOP 1.71
  
• d1xuia_ appears in SCOP 1.75
  
• d1xuia_ appears in the current release, SCOPe 2.08