SCOPe 2.04: Domain d4qytb_: 4qyt B:

Lineage for d4qytb_ (4qyt B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (15 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [226442] (4 PDB entries)

8. Domain d4qytb_: 4qyt B: [258817]
   automated match to d4gdhb_
   complexed with edo, mg

Details for d4qytb_

PDB Entry: 4qyt, 1.05 Å

PDB Description: schizosaccharomyces pombe dj-1

PDB Compounds: (B:) Uncharacterized protein C22E12.03c

SCOPe Domain Sequences for d4qytb_:

Sequence; same for both SEQRES and ATOM records:

>d4qytb_ c.23.16.0 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsykei
psaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagtltaktsg
lpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdky
navykslsmp

Timeline for d4qytb_:

• d4qytb_ is new in SCOPe 2.04-stable
  
• d4qytb_ appears in SCOPe 2.05
  
• d4qytb_ appears in the current release, SCOPe 2.08