SCOPe 2.08: Domain d4qwoa1: 4qwo A:1-133

Lineage for d4qwoa1 (4qwo A:1-133)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.0: automated matches [191571] (1 protein)
   not a true family

6. Protein automated matches [190990] (3 species)
   not a true protein

7. Species Monkeypox virus [TaxId:619591] [258808] (1 PDB entry)

8. Domain d4qwoa1: 4qwo A:1-133 [258810]
   Other proteins in same PDB: d4qwoa2
   automated match to d2vk3a_
   complexed with cl, edo, pe8, peg

Details for d4qwoa1

PDB Entry: 4qwo, 1.52 Å

PDB Description: 1.52 angstrom crystal structure of a42r profilin-like protein from monkeypox virus zaire-96-i-16

PDB Compounds: (A:) Profilin

SCOPe Domain Sequences for d4qwoa1:

Sequence; same for both SEQRES and ATOM records:

>d4qwoa1 d.110.1.0 (A:1-133) automated matches {Monkeypox virus [TaxId: 619591]}
maewhkiiedisknnkfedaaivdykttknvlaaipnrtfakinpgeviplitnhnilkp
ligqkfcivytnslmdentyamelltgyapvspiviarthtaliflmgkpttsrrdvyrt
crdhatrvratgn

Timeline for d4qwoa1:

• d4qwoa1 first appeared in SCOPe 2.04, called d4qwoa_
  
• d4qwoa1 appears in SCOPe 2.07