Lineage for d2tlde_ (2tld E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794264Protein Trypsin(ogen) [50515] (9 species)
  7. 1794282Species Cow (Bos taurus) [TaxId:9913] [50516] (396 PDB entries)
    Uniprot P00760
  8. 1794687Domain d2tlde_: 2tld E: [25881]
    Other proteins in same PDB: d2tldi_

Details for d2tlde_

PDB Entry: 2tld (more details), 2.6 Å

PDB Description: crystal structure of an engineered subtilisin inhibitor complexed with bovine trypsin
PDB Compounds: (E:) Trypsin

SCOPe Domain Sequences for d2tlde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tlde_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagleggdscqgdsggpvv
csgklqgivswgsgcaknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d2tlde_:

Click to download the PDB-style file with coordinates for d2tlde_.
(The format of our PDB-style files is described here.)

Timeline for d2tlde_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2tldi_