SCOPe 2.05: Domain d2tlde_: 2tld E:

Lineage for d2tlde_ (2tld E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (396 PDB entries)
   Uniprot P00760

8. Domain d2tlde_: 2tld E: [25881]
   Other proteins in same PDB: d2tldi_

Details for d2tlde_

PDB Entry: 2tld, 2.6 Å

PDB Description: crystal structure of an engineered subtilisin inhibitor complexed with bovine trypsin

PDB Compounds: (E:) Trypsin

SCOPe Domain Sequences for d2tlde_:

Sequence; same for both SEQRES and ATOM records:

>d2tlde_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagleggdscqgdsggpvv
csgklqgivswgsgcaknkpgvytkvcnyvswikqtiasn

Timeline for d2tlde_:

• d2tlde_ first appeared (with stable ids) in SCOP 1.55
  
• d2tlde_ appears in SCOPe 2.04
  
• d2tlde_ appears in SCOPe 2.06
  
• d2tlde_ appears in the current release, SCOPe 2.08