SCOP 1.67: Domain d2tlde_: 2tld E:

Lineage for d2tlde_ (2tld E:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (213 PDB entries)

8. Domain d2tlde_: 2tld E: [25881]
   Other proteins in same PDB: d2tldi_

Details for d2tlde_

PDB Entry: 2tld, 2.6 Å

PDB Description: crystal structure of an engineered subtilisin inhibitor complexed with bovine trypsin

SCOP Domain Sequences for d2tlde_:

Sequence; same for both SEQRES and ATOM records:

>d2tlde_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagleggdscqgdsggpvv
csgklqgivswgsgcaknkpgvytkvcnyvswikqtiasn

Timeline for d2tlde_:

• d2tlde_ first appeared (with stable ids) in SCOP 1.55
  
• d2tlde_ appears in SCOP 1.65
  
• d2tlde_ appears in SCOP 1.69
  
• d2tlde_ appears in the current release, SCOPe 2.08