Lineage for d2tlde_ (2tld E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries) 
Domain d2tlde_: 2tld E: [25881]
Other proteins in same PDB: d2tldi_
Details for d2tlde_
PDB Entry: 2tld (more details), 2.6 Å
PDB Description: crystal structure of an engineered subtilisin inhibitor complexed with bovine trypsin
SCOP Domain Sequences for d2tlde_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tlde_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagleggdscqgdsggpvv
csgklqgivswgsgcaknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d2tlde_:
Click to download the PDB-style file with coordinates for d2tlde_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tlde_:
- d2tlde_ appears in SCOP 1.57
- d2tlde_ appears in the current release, SCOPe 2.08
View in 3D
