Lineage for d4qnhr_ (4qnh R:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319893Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
    Duplication: made with two pairs of EF-hands
  6. 2319950Protein Calmodulin [47516] (12 species)
  7. 2320228Species Norway rat (Rattus norvegicus) [TaxId:10116] [158477] (17 PDB entries)
  8. 2320243Domain d4qnhr_: 4qnh R: [258806]
    Other proteins in same PDB: d4qnhb1, d4qnhb2, d4qnhb3
    automated match to d4djca_
    complexed with ca, so4

Details for d4qnhr_

PDB Entry: 4qnh (more details), 2.02 Å

PDB Description: Calcium-calmodulin (T79D) complexed with the calmodulin binding domain from a small conductance potassium channel SK2-a
PDB Compounds: (R:) calmodulin

SCOPe Domain Sequences for d4qnhr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qnhr_ a.39.1.5 (R:) Calmodulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
tidfpefltmmarkmkdddseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev
demireadidgdgqvnyeefvqmmta

SCOPe Domain Coordinates for d4qnhr_:

Click to download the PDB-style file with coordinates for d4qnhr_.
(The format of our PDB-style files is described here.)

Timeline for d4qnhr_: