Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (8 proteins) Pfam PF00567 |
Protein automated matches [190752] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187947] (4 PDB entries) |
Domain d4qq6a_: 4qq6 A: [258805] automated match to d4a4ga_ protein/RNA complex; complexed with 36x, unx |
PDB Entry: 4qq6 (more details), 1.75 Å
SCOPe Domain Sequences for d4qq6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qq6a_ b.34.9.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdllspice
Timeline for d4qq6a_: