Lineage for d4qq6a_ (4qq6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784518Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. 2784675Protein automated matches [190752] (1 species)
    not a true protein
  7. 2784676Species Human (Homo sapiens) [TaxId:9606] [187947] (8 PDB entries)
  8. 2784677Domain d4qq6a_: 4qq6 A: [258805]
    automated match to d4a4ga_
    protein/RNA complex; complexed with 36x, unx

Details for d4qq6a_

PDB Entry: 4qq6 (more details), 1.75 Å

PDB Description: crystal structure of tudor domain of smn1 in complex with a small organic molecule
PDB Compounds: (A:) Survival motor neuron protein

SCOPe Domain Sequences for d4qq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qq6a_ b.34.9.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdllspice

SCOPe Domain Coordinates for d4qq6a_:

Click to download the PDB-style file with coordinates for d4qq6a_.
(The format of our PDB-style files is described here.)

Timeline for d4qq6a_: