Lineage for d4qj1c1 (4qj1 C:1-399)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080779Species Cryptosporidium parvum [TaxId:5807] [234914] (4 PDB entries)
  8. 2080790Domain d4qj1c1: 4qj1 C:1-399 [258798]
    Other proteins in same PDB: d4qj1b2, d4qj1c2, d4qj1d2
    automated match to d4my1c_
    complexed with acy, edo, fmt, imp, n09

Details for d4qj1c1

PDB Entry: 4qj1 (more details), 2.42 Å

PDB Description: co-crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from cryptosporidium parvum with inhibitor n109
PDB Compounds: (C:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d4qj1c1:

Sequence, based on SEQRES records: (download)

>d4qj1c1 c.1.5.0 (C:1-399) automated matches {Cryptosporidium parvum [TaxId: 5807]}
mgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmav
gmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivl
dsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsicttr
ivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagte
espgekeligdtvykyyrgmgsvgamksgsgdryfqekrpenkmvpegiegrvkykgeme
gvvyqlvgglrscmgylgsasieelwkkssyveittsglreshvhdveivkevmnys

Sequence, based on observed residues (ATOM records): (download)

>d4qj1c1 c.1.5.0 (C:1-399) automated matches {Cryptosporidium parvum [TaxId: 5807]}
mgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmav
gmarlggigiihknmdmesqvnevlkvknsgglrvgaaigvneierakllveagvdvivl
dsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvgigpgsicttr
ivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagte
espgekeligdtvykyyrgmgsvgamksnkmvpegiegrvkykgemegvvyqlvgglrsc
mgylgsasieelwkkssyveittsglreshvhdveivkevmnys

SCOPe Domain Coordinates for d4qj1c1:

Click to download the PDB-style file with coordinates for d4qj1c1.
(The format of our PDB-style files is described here.)

Timeline for d4qj1c1: