Lineage for d4qa3a_ (4qa3 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599042Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1599043Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1599321Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 1599355Protein automated matches [190786] (1 species)
    not a true protein
  7. 1599356Species Human (Homo sapiens) [TaxId:9606] [188039] (20 PDB entries)
  8. 1599390Domain d4qa3a_: 4qa3 A: [258794]
    automated match to d2v5wb_
    complexed with gol, k, tsn, zn

Details for d4qa3a_

PDB Entry: 4qa3 (more details), 2.88 Å

PDB Description: Crystal structure of T311M HDAC8 in complex with Trichostatin A (TSA)
PDB Compounds: (A:) Histone deacetylase 8

SCOPe Domain Sequences for d4qa3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qa3a_ c.42.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq
afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlanmar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvvi

SCOPe Domain Coordinates for d4qa3a_:

Click to download the PDB-style file with coordinates for d4qa3a_.
(The format of our PDB-style files is described here.)

Timeline for d4qa3a_: