Lineage for d4qa1b1 (4qa1 B:14-377)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2874190Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 2874235Protein automated matches [190786] (1 species)
    not a true protein
  7. 2874236Species Human (Homo sapiens) [TaxId:9606] [188039] (41 PDB entries)
  8. 2874251Domain d4qa1b1: 4qa1 B:14-377 [258791]
    Other proteins in same PDB: d4qa1b2, d4qa1d2
    automated match to d2v5wb_
    complexed with b3n, gol, k, zn

Details for d4qa1b1

PDB Entry: 4qa1 (more details), 1.92 Å

PDB Description: Crystal structure of A188T HDAC8 in complex with M344
PDB Compounds: (B:) Histone deacetylase 8

SCOPe Domain Sequences for d4qa1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qa1b1 c.42.1.2 (B:14-377) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedtfsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq
afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvv

SCOPe Domain Coordinates for d4qa1b1:

Click to download the PDB-style file with coordinates for d4qa1b1.
(The format of our PDB-style files is described here.)

Timeline for d4qa1b1: