Lineage for d2tgd__ (2tgd -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries) 
Domain d2tgd__: 2tgd - [25879]
Details for d2tgd__
PDB Entry: 2tgd (more details), 2.1 Å
PDB Description: lack of the transition state stabilization site is a factor in the inactivity of trypsinogen, a serine protease zymogen. structure of dfp inhibited bovine trypsinogen at 2.1 angstroms resolution
SCOP Domain Sequences for d2tgd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tgd__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
vggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvvegn
eqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgw
gntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpv
vcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d2tgd__:
Click to download the PDB-style file with coordinates for d2tgd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tgd__:
- d2tgd__ appears in SCOP 1.57
- d2tgd__ appears in the current release, SCOPe 2.08, called d2tgda_
View in 3D