Lineage for d4qa0b_ (4qa0 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129859Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2129860Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2130138Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 2130181Protein automated matches [190786] (1 species)
    not a true protein
  7. 2130182Species Human (Homo sapiens) [TaxId:9606] [188039] (33 PDB entries)
  8. 2130212Domain d4qa0b_: 4qa0 B: [258788]
    Other proteins in same PDB: d4qa0a2
    automated match to d2v5wb_
    complexed with gol, k, shh, zn

Details for d4qa0b_

PDB Entry: 4qa0 (more details), 2.24 Å

PDB Description: Crystal structure of C153F HDAC8 in complex with SAHA
PDB Compounds: (B:) Histone deacetylase 8

SCOPe Domain Sequences for d4qa0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qa0b_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhhakkdeasgffylndavlgilrlrrkferilyvdldlhhgdgvedafsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq
afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvv

SCOPe Domain Coordinates for d4qa0b_:

Click to download the PDB-style file with coordinates for d4qa0b_.
(The format of our PDB-style files is described here.)

Timeline for d4qa0b_: