Lineage for d4pxhc_ (4pxh C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2723142Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2723143Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2724019Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2724020Protein automated matches [190847] (99 species)
    not a true protein
  7. 2724821Species Streptomyces sp. [TaxId:1001349] [258247] (2 PDB entries)
  8. 2724823Domain d4pxhc_: 4pxh C: [258782]
    Other proteins in same PDB: d4pxhb1, d4pxhb2, d4pxhd1, d4pxhd2, d4pxhf1, d4pxhf2
    automated match to d1t87a_
    complexed with hem, kh4

Details for d4pxhc_

PDB Entry: 4pxh (more details), 2.7 Å

PDB Description: Structure of P450sky (CYP163B3), a cytochrome P450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
PDB Compounds: (C:) P450 monooxygenase

SCOPe Domain Sequences for d4pxhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pxhc_ a.104.1.0 (C:) automated matches {Streptomyces sp. [TaxId: 1001349]}
distinltdprtyevndlseywrqlrttrplywhppvgdapgfwvvsryadvmalykdnk
kltsekgnvlvtllaggdsaagkmlavtdgamhrglrnvllksfspqalkpivdqirvnt
trlvvdaarrgecdfaadvaeqiplntisdllgvpaadrefllklnksalssedadqsat
dawlarneillyfselvaerrakptedvisvlansmvdgkplteevivlncyslilggde
tsrlsmidsvqtftqypdqwellrdgkvtlesateevlrwatpamhfgrravtdmelhgq
viaagdvvtlwnnsanrdeevfadpyafdlnrspnkhitfgygphfclgaylgraevhal
ldalrtyttgfeitgepqrihsnfltglsrlpvriqpneaaiaaydsdn

SCOPe Domain Coordinates for d4pxhc_:

Click to download the PDB-style file with coordinates for d4pxhc_.
(The format of our PDB-style files is described here.)

Timeline for d4pxhc_: